Domain Names Owned by CVS Health

Whois XML Api

Today we feature CVS Health, in our series of Domain Names Owned by: You can view some of our previous posts, that have featured AT&T, AppleFordFacebookGeicoGeneral Motors1-800 Flowers, and also domain name investors portfolios too.

How do we find out who owns these domain names, well we use a feature called Reverse Whois Search with our partners WhoisXMLApi.com, they scan for the chosen term in this instance was domain names related to the registrant email address that CVS Health uses for domain registrations which is “domains’at’caremark.com” and we get the results of over 1146 domain names that CVS Health has registered to them.

CVS Health is an American healthcare company that owns CVS , a retail pharmacy chain, CVS Caremark, a pharmacy benefits manager, Aetna, a health insurance provider, among many other brands. The companies headquarter is in Woonsocket, Rhode Island.

Register Your Domain Name Below using these links and help keep Robbies Blog online – We earn a tiny commission should decide to register a domain name using the links below – Thank You!

Epik.com – GoDaddy.com  – NameSilo.com –  Dynadot.com –  NameCheap.com

Domain Names Owned by CVS Health
1800shopcvs.com
4seniorcarerx.com
75thstreetwineclub.com
abdrx.com
abilitiescvs.com
access2savings.com
accordant.com
accordant.net
accordantfacts.com
acmcentral.com
acropharmacy.com
acs-rx.com
acs-rx.net
activitytool.com
adprx.com
adprx.net
advancedcarescript.com
advancedcarescripts.com
advanceparadigm.com
advancepcs.com
advancepcsonline.net
advancepcsrx.com
advancerx.com
advancerx.net
advancerxnews.com
advpcslab.com
aetna-cvshealth.com
aetnacarepass.com
aetnacarepass.net
aetnacvs.us
aetnakidneysupport.com
aetnarxhealthalerts.com
affordablepartdpremiums.com
aiscare.com
al1terpatientregistry.com
al1terpatientregistry.net
allaboutcvscaremark.com
allaboutcvscaremark.net
alpha1source.com
alpha1source.net
alterpatientregistry.com
alterpatientregistry.net
altsample.com
ancillarycaremanagement.com
apnacvs.com
askcvs.com
asklongsdrugs.com
bcrgcvs.com
beauty360.com
beauty360events.com
beauty360online.com
beauty360shop.com
beauty360store.com
beautyirl.com
beautythreesixty.com
beautyunfiltered.com
beneverepharma.com
beneverepharmacy.com
beneverespecialtypharmacy.com
betterresultswithcvshealth.com
bluegrass-pharmacy.com
bluegrass-rx.com
briteedge.com
briteedge.net
buildingbetterhealth.com
buycvspharmacy.com
cairpatientregistry.com
cairpatientregistry.net
career-cvs.com
careers-cvs.net
careerscvs.com
careforlife.com
caremark.com
caremark.net
caremark.pharmacy
caremarkblockchain.com
caremarkbrandcenter.com
caremarkcarepass.com
caremarkcares.net
caremarkclient.com
caremarkclient.net
caremarkclients.com
caremarkclients.net
caremarkcloud.us
caremarkconnect.com
caremarkconnect.net
caremarkdiversity.com
caremarkdiversity.net
caremarkextracare.com
caremarkfacts.com
caremarkgroup.com
caremarkgroup.net
caremarkinfo.com
caremarkinfo.net
caremarkinternships.com
caremarkjobs.com
caremarkjobs.net
caremarkmedicare.com
caremarkmedicare.us
caremarkonline.com
caremarkonline.net
caremarkpcs.net
caremarkpharmacies.com
caremarkpharmacies.net
caremarkpharmtech.com
caremarkpromo.com
caremarkrphcareers.com
caremarkrx.com
caremarkrx.net
caremarkrxalerts.com
caremarkrxinc.net
caremarkrxt.net
caremarksupplierdiversity.com
caremarksupplierdiversity.net
caremarktoolkit.com
caremarkusa.com
caremarkusa.net
caremart.com
caremart.net
carepassbenefits.com
carepasscare.com
carepasspromo.com
carepattern.com
carepattern.net
carepatterns.com
carepatterns.net
carestartshere.com
carestartshere.net
cbvshealth.com
ccvshealth.com
cfvshealth.com
cgvshealth.com
choosesilverscript.com
clearrx.us
clearx.us
clinicsincvs.com
clinicsincvs.net
cmcrequest.com
cmcrequest.net
commcarepharmacy.com
commcarepharmacy.net
commcarereports.com
commcarespecialtypharmacy.com
commcarespecialtypharmacy.net
community2010.com
communityccrxplans.com
communityforme.com
communitypharmacists.com
communitypharmacists.net
communitypharmacists.us
communitypharmacistsrx.com
communitypharmacistsrx.net
communitypharmacistsrx.us
connecthealthrx.com
connecthealthrx.net
consumerhealthinteractive.com
consumerhealthinteractive.net
consumerhi.com
consumerhi.net
consumervaluestores.com
consumervaluestores.net
coram-hc.com
coram-healthcare.com
coramais.com
coramais.net
coramcardiology.com
coramcardiology.net
coramclinicaltrials.com
coramclinicaltrials.net
coramconnections.com
coramct.com
coramcti.com
coramfacts.com
coramhc.com
coramhc.net
coramhcblockchain.com
coramhcfacts.com
coramhealthcare.com
coramhemophilia.com
coramhemophilia.net
coramig.com
coramig.net
coraminc.com
coramrx.com
coramrx.net
covid-19cvs.com
covid19cvs.com
craemark.com
cspharmacy.net
ctinetworkinc.com
cv-survey.com
cvacaremark.com
cvashealth.com
cvdshealth.com
cvehealth.com
cveshealth.com
cvhsealth.com
cvs-careers.com
cvs-caremark.com
cvs-corp.com
cvs-employment.com
cvs-internal.com
cvs-iq.com
cvs-iq.net
cvs-learn.net
cvs-pharma-pills.com
cvs-store.com
cvs-stores.com
cvs-survey.com
cvs.com
cvs.pharmacy
cvs401k.com
cvsad.com
cvsadd.us
cvsadds.us
cvsaetna.com
cvsaetna.us
cvsallkidscan.com
cvsbealth.com
cvsbetterideas.com
cvsbhealth.com
cvsblockchain.com
cvsbonusbucks.com
cvsbonusbucks.net
cvsboston.com
cvsbrand.com
cvsbrand.net
cvsbrandcenter.com
cvsbrands.com
cvsbuysellpharmacy.com
cvscairemark.com
cvscare.net
cvscaremark.com
cvscaremark.net
cvscaremark.pharmacy
cvscaremark.us
cvscaremark401k.com
cvscaremarkallkidscan.com
cvscaremarkblockchain.com
cvscaremarkblog.com
cvscaremarkbrandcenter.com
cvscaremarkcharityclassic.com
cvscaremarkcharityclassic.net
cvscaremarkcommunitycrew.com
cvscaremarkcorp.com
cvscaremarkcorporate.com
cvscaremarkcorporatecommunications.com
cvscaremarkcorporatecommunications.net
cvscaremarkd.com
cvscaremarkd.net
cvscaremarkd.us
cvscaremarkdigitalalerts.com
cvscaremarkdowntown5k.com
cvscaremarkdowntown5k.net
cvscaremarkdscript.com
cvscaremarkdscript.net
cvscaremarkdscript.us
cvscaremarkfacts.com
cvscaremarkfyi.com
cvscaremarkfyi.net
cvscaremarkhub.com
cvscaremarkimmunizations.com
cvscaremarkinternship.com
cvscaremarkinternships.com
cvscaremarkleadership.com
cvscaremarklivingd.com
cvscaremarkmedicare.com
cvscaremarkmedicare.us
cvscaremarkmyd.com
cvscaremarkmyd.net
cvscaremarkmyd.us
cvscaremarknow.com
cvscaremarkonline.com
cvscaremarkoutcomes.com
cvscaremarkpa.com
cvscaremarkpartdservices.com
cvscaremarkpromo.com
cvscaremarkrealty.com
cvscaremarkred.com
cvscaremarkred.net
cvscaremarkred.us
cvscaremarkresults.com
cvscaremarkrx.com
cvscaremarkrxalerts.com
cvscaremarksd.com
cvscaremarksd.net
cvscaremarksimplyd.com
cvscaremarksimplyd.net
cvscaremarksimplyd.us
cvscaremarksite.com
cvscaremarkspecialtypharmacy.com
cvscaremarkspecialtypharmacy.net
cvscaremarkspecialtyrx.com
cvscaremarkspecialtyrx.net
cvscaremarksupplierdiversity.com
cvscaremarksupplierdiversity.net
cvscaremarksuppliersnonmerch.com
cvscaremarktoday.com
cvscaremarktoolkit.com
cvscarepass.com
cvscarepass.net
cvscaresmark.com
cvscatalog.com
cvscatalog.net
cvscavemark.com
cvsceremark.com
cvschaindrug.com
cvschaindrug.net
cvsclearance.com
cvsclinics.com
cvsclinics.net
cvsconstructionpropertyadmin.com
cvscorp.com
cvscorporation.com
cvscovid-19.com
cvscovid19.com
cvscovidsurvey.com
cvscraze.com
cvscraze.net
cvsdelivery.com
cvsdirect.com
cvsdirect.net
cvsdrug.com
cvsdrugs.com
cvsdrugstore.com
cvsdrugstore.net
cvsdscript.com
cvsdscript.net
cvsdscript.us
cvseasyprescription.com
cvseasyrx.com
cvseasyscript.com
cvseasytreats.com
cvsedi.com
cvsehalth.com
cvsemployeeportal.com
cvsessenceofbeauty.com
cvsessenceofbeauty.net
cvsexpress.com
cvsextrabucks.com
cvsextrabucks.net
cvsextracare.com
cvsextracare.net
cvsextracaregold.com
cvsextracaregold.net
cvsezprescription.com
cvsezrx.com
cvsezscript.com
cvsfacts.com
cvsfitnessurvey.us
cvsforbusiness.com
cvsfred.com
cvsfreeextras.com
cvsfreeextras.net
cvsfriendsandfamily.com
cvsfuck.com
cvsgealth.com
cvsghealth.com
cvsgold.net
cvsgoldcare.com
cvsgoldcare.net
cvsgolf.com
cvsgroupco.com
cvsgroupcorp.com
cvsgroupcorporation.com
cvsh3alth.com
cvsh3ealth.com
cvsh4alth.com
cvsh4ealth.com
cvshaelth.com
cvshalth.com
cvshalthsurvey.com
cvshdalth.com
cvshdealth.com
cvsheaalth.com
cvsheaith.com
cvsheaklth.com
cvsheal.com
cvsheal5h.com
cvsheal5th.com
cvsheal6h.com
cvsheal6th.com
cvshealfh.com
cvshealfth.com
cvshealgh.com
cvshealgth.com
cvsheallth.com
cvshealrh.com
cvshealrth.com
cvshealtb.com
cvshealtbh.com
cvshealtg.com
cvshealtgh.com
cvshealth-helpingyousucceed.com
cvshealth-hub.com
cvshealth-support.com
cvshealth.com
cvshealth.net
cvshealth1.com
cvshealthalerts.com
cvshealthannualmeeting.com
cvshealthblockchain.com
cvshealthbrandcenter.com
cvshealthbrandcentercr.com
cvshealthcaredesk.com
cvshealthcareer.com
cvshealthcareers.com
cvshealthcharityclassic.com
cvshealthclinic.com
cvshealthcloud.com
cvshealthco.com
cvshealthcommunitycrew.com
cvshealthcorp.com
cvshealthcorporation.com
cvshealthdeliveringresults.com
cvshealthdeliveringyourresults.com
cvshealthfacts.com
cvshealthforum.com
cvshealthh.com
cvshealthhelpingyousucceed.com
cvshealthhonors.com
cvshealthhub.com
cvshealthhub.net
cvshealthhub.us
cvshealthhublocations.com
cvshealthhubs.com
cvshealthhubs.net
cvshealthhubs.us
cvshealthhubstores.com
cvshealthleadingtogether.com
cvshealthleadingwithheart.com
cvshealthmedia.com
cvshealthmoments.com
cvshealthmomentsthatmatter.com
cvshealthmtm.com
cvshealthonors.com
cvshealthpayers.com
cvshealthpayersolutions.com
cvshealthpayors.com
cvshealthpayorsolutions.com
cvshealthpharmacy.com
cvshealthportal.com
cvshealthpromo.com
cvshealthpromoproducts.com
cvshealthresources.com
cvshealthresources.net
cvshealthrewards.com
cvshealths.com
cvshealthservice.com
cvshealthsolutions.com
cvshealthssurvey.com
cvshealthstore.net
cvshealthsupplierdiversity.com
cvshealthsurvey.com
cvshealthsurvey.net
cvshealthsurvry.com
cvshealthub.com
cvshealthyoutcomes.com
cvshealtj.com
cvshealtjh.com
cvshealtn.com
cvshealtnh.com
cvshealtth.com
cvshealtu.com
cvshealtuh.com
cvshealty.com
cvshealtyh.com
cvshealyh.com
cvshealyth.com
cvsheaolth.com
cvsheaoth.com
cvsheaplth.com
cvsheapth.com
cvshearing.com
cvsheath.net
cvsheathsurvey.net
cvsheealth.com
cvsheqalth.com
cvsheqlth.com
cvshesalth.com
cvshewalth.com
cvshewlth.com
cvshezalth.com
cvshezlth.com
cvshhealth.com
cvshomehealth.com
cvshomehealth.net
cvshomehealthcare.com
cvshomehealthcare.net
cvshowwework.com
cvshralth.com
cvshrealth.com
cvshsalth.com
cvshsealth.com
cvshubcareer.com
cvshubcareer.net
cvshubcareer.us
cvshubcareers.com
cvshublogin.com
cvshublogin.net
cvshublogin.us
cvshubsurvey.com
cvshubsurveys.com
cvshubsurveys.net
cvshubsurveys.us
cvshumanresources.com
cvshwalth.com
cvshwealth.com
cvsinc.com
cvsinfocenter.com
cvsinternship.com
cvsinternships.com
cvsiq.net
cvsisave.com
cvsisave.net
cvsjealth.com
cvsjhealth.com
cvsjobreviews.com
cvskidneycare.com
cvskidneycare.us
cvskidneycareapp.com
cvslearnet.com
cvslearnnet.com
cvslhealth.com
cvslivingd.com
cvslivingd.net
cvslivingd.us
cvslogin.com
cvsmedicationreminders.com
cvsminuteclinic.com
cvsminuteclinicfacts.com
cvsmoments.com
cvsmomentsthatmatter.com
cvsmyd.com
cvsmyd.net
cvsmyd.us
cvsmyhr.net
cvsmylife.com
cvsmynet.com
cvsmyweeklyad.com
cvsnealth.com
cvsnearme.com
cvsnhealth.com
cvsomnicare.com
cvsomnicare.net
cvsonlinehub.com
cvsonlinemeds.com
cvsonlinepharmacy.com
cvsonlinepharmacy.net
cvsonlinepharmacystore.com
cvsopenbuydays.com
cvspainrelief.com
cvspassword.com
cvspatientsafety.com
cvspayersolutions.com
cvspayfelxdirect.com
cvspayorsolutions.com
cvspecialty.com
cvspecialty.pharmacy
cvspharm.net
cvspharma.com
cvspharmacare.com
cvspharmacies.com
cvspharmacies.net
cvspharmacology.com
cvspharmacy.com
cvspharmacy.net
cvspharmacy.us
cvspharmacyacquisition.com
cvspharmacyacquisitions.com
cvspharmacyfacts.com
cvspharmacyhub.com
cvspharmacylisting.com
cvspharmacyonline.com
cvspharmacyqa.com
cvspharmacyrealty.com
cvspharmacys.com
cvspharmacyshop.com
cvspharmacystore.com
cvspharmahub.com
cvspharmarx.com
cvspharmausa.com
cvspharnamcy.com
cvsphoto.com
cvsphoto.net
cvsphotocenter.com
cvsphotocenter.net
cvsprescriptions.com
cvsprescriptions.net
cvsprojecthealth.com
cvsprojectordering.com
cvsquits.us
cvsred.com
cvsred.net
cvsred.us
cvsreminders.com
cvsreports.com
cvsresearch.com
cvsreward.com
cvsrewards.com
cvsrewards.net
cvsrhodeisland.com
cvsrlc.com
cvsrx.com
cvsrx.net
cvsrxonline.com
cvsrxreload.com
cvssavingscentral.com
cvsscaremark.com
cvssdpecialty.com
cvssecialty.com
cvsshealth.com
cvssimplyd.com
cvssimplyd.net
cvssimplyd.us
cvssolutions.com
cvssolutionscorporation.com
cvsspcialty.com
cvsspecalty.com
cvsspecialcare.com
cvsspecialcare.net
cvsspecialityinsight.com
cvsspeciallty.com
cvsspecialt.com
cvsspecialtty.com
cvsspecialty.com
cvsspecialty.pharmacy
cvsspecialtyexpedite.com
cvsspecialtyfacts.com
cvsspecialtyinsight.com
cvsspecialtypharmacyprogram.com
cvsspecialy.com
cvsspeciaty.com
cvsspecilty.com
cvsspeialty.com
cvssprojecthealth.com
cvsssurvey.com
cvsstandards.com
cvsstores.com
cvsstores.net
cvsstoreshealthcare.com
cvsstyleguide.com
cvsstyleguide.net
cvssupplierdiversity.com
cvssupplierdiversity.net
cvssuppliers.com
cvssurvey.com
cvssurvey.net
cvssurveyff.com
cvssurveys.com
cvssurveysss.com
cvstelemedicine.com
cvstestlab.com
cvsthelayoff.com
cvstoday.com
cvstoday.net
cvstransitions.com
cvstransitions.net
cvstransitions.us
cvstravel.com
cvsuealth.com
cvsuhealth.com
cvsurveys.com
cvsusers.net
cvsventures.com
cvsvision.com
cvsvitamins.com
cvsvitamins.net
cvsweeklyads.com
cvswellcare.com
cvsworkplace.com
cvsxtracare.com
cvsxtracare.net
cvsyealth.com
cvsyhealth.com
cvsymas.com
cvsymas.net
cvsymas.us
cvsymasencuesta.com
cvvs.com
cvvshealth.com
cvvsprojecthealth.com
cvwshealth.com
cvxhealth.com
cvxshealth.com
cvzhealth.com
cvzshealth.com
dc-careers-cvs.com
dcvshealth.com
deliveringyourresultscvshealth.com
discovercvscaremark.com
discovercvscaremark.net
dispensingwellness.com
drivencvs.com
drogariaonofrefacts.com
druglist.com
drugscvs.com
dvshealth.com
efportal.com
encompassfertility.com
encompassrx.com
enrollmentportals.com
entrustrx.com
escalantesolutions.com
escalantesolutions.net
essenceofbeauty.com
extracaregold.com
extracaregold.net
extracarehealthbenefit.com
extracarehealthcard.com
eyeontherapy.com
eyeontherapy.net
faithcvs.com
familyexpressclinic.com
familymatterscvs.com
fastclinic.net
fasttrackclinic.net
fcvshealth.com
fitclubcvs.com
flushotcvs.us
formularyreferencepage.com
fuckcvs.com
fvshealth.com
generationhealth.com
generationhealthcorp.com
generationhealthcorp.net
goldenbuckeyemedicare.com
gomedcare.com
gomedcare.net
gpcgreview.com
greenteamcvs.com
groupcvs.com
growcare.com
growcare.net
haelppatientregistry.com
haelppatientregistry.net
healthcarecvs.com
healthcareforward.com
healthextrasmail.com
healthextrasmail.net
healthhublocations.com
healthintegration.com
healthsavingspass.com
healthsavingspass.net
healthyresults.com
helenafoulkes.com
helpingyousucceed-cvshealth.com
helpingyousucceedcvshealth.com
hemophiliacare.net
hepcare.com
hepcare.net
hubforbetterhealth.com
iastral.com
ibelongatcvs.com
ibelongatcvscaremark.com
ibelongatcvspharmacy.com
idealpatientregistry.com
idealpatientregistry.net
idealpatientregistryprogram.com
idealpatientregistryprogram.net
igivcare.com
igivcare.net
ihateminuteclinic.com
ihateminuteclinic.net
ihealthcare.com
illinicare.com
illuvianaccessplus.com
imrinc.com
iq-cvs.com
iq-cvs.net
iq-purchasing.com
iq-purchasing.net
iqcvs.com
iqcvs.net
iqpurchasing.net
isavecvs.com
isavecvs.net
isavecvs.us
iscribe.com
ivmed.com
kioskcvshealth.com
kioskcvshealth.net
kpnw-escalantesolutions.com
larrymerlo.com
legalminuteclinic.com
legitcvshealthsolution.com
livebetterbaby.net
livebetterbecauseyoucan.com
livebetterbecauseyoucan.net
livebetterdrugstore.com
livebetterpet.com
livebetterwellness.com
logincvs.com
long-drug.com
long-drugs-stores.com
longdrugs.com
longdrugsstore.com
longdrugsstore.net
longdrugsstores.com
longdrugstore.net
longdrugstores.us
longliveskin.com
longpharmacies.net
longpharmacy.net
longs-drug-stores.com
longs-drug.com
longs-drugs-store.com
longs-drugs.com
longs-drugsstores.com
longs-mailorder.com
longs-mailorder.net
longs.com
longsbod.com
longsdrug-store.com
longsdrug.com
longsdrug.net
longsdrugs.com
longsdrugs.net
longsdrugs.us
longsdrugsfacts.com
longsdrugsstores.net
longsdrugstore.net
longsdrugstores.net
longsdrugstores.us
longsdrugsurvey.com
longsfacts.com
longsmailorder.com
longsmailorder.net
longspharmacies.com
longspharmacies.net
longspharmacy.com
longspharmacy.net
longsvendors.com
longsvendors.net
m-cvs.com
manageyourpbm.com
maturerx.com
mcproviderscheduling.com
meddweb.com
meddweb.net
meddweb.us
medicalpharmacysavings.com
medicarepartdportal.com
medicareplanrx.com
medicareplanrx.net
membercarerx.com
membercarerx.net
membercarerx.us
memberchoicerx.com
memberchoicerx.net
memberchoicerx.us
memberhealth.cn
memberhealth.com
memberhealth.net
memberhealth.us
memberhealthgroups.com
memberhealthgroups.net
memberhealthgroups.us
merwiniv.com
merwiniv.net
merwinltc.com
merwinltc.net
mhrx.com
mhrxgroups.com
mhrxgroups.net
mhrxgroups.us
miniuteclinichubs.com
miniuteclinichubs.net
miniuteclinichubs.us
minutclinic.com
minutclinic.net
minute-clinic.com
minute-clinic.net
minutecinic.com
minuteclinc.com
minuteclincs.com
minuteclinic-sucks.com
minuteclinic-sucks.net
minuteclinic.com
minuteclinic.us
minuteclinicblockchain.com
minuteclinicblows.com
minuteclinicblows.net
minuteclinicbrandcenter.com
minuteclinicconnect.com
minuteclinicfacts.com
minuteclinicisslow.com
minuteclinicisslow.net
minuteclinicmakesmesick.com
minuteclinicmakesmesick.net
minuteclinicmarketing.com
minuteclinicmom20.com
minuteclinicnyc.com
minutecliniconline.com
minuteclinicpatientsurvey.com
minuteclinicpatientsurveys.com
minuteclinics.com
minuteclinics.net
minuteclinicsucks.com
minuteclinicsucks.net
minuteclinicsurvey.com
minuteclinicsurveys.com
minuteclinictoolkit.com
minuteclinictwitter.com
minutemedicalclinic.com
minutemedicalclinic.net
minutepharmacy.com
mma-mailorder.com
mma-mailorder.net
mmamailorder.com
mmamailorder.net
msbrownscvs.com
multiplesclerosiscare.com
multiplesclerosiscare.net
mybeauty360.com
mybenefitshighway.com
mycaremark.com
mycaremark.net
myconnectionsfeedback.com
mycoram.com
mycoram.net
mycvs.com
mycvs.net
mycvs.us
mycvscareers.com
mycvscaremark.com
mycvshealth.com
mycvshealthhub.com
mygenerationhealth.com
mygenerationhealth.net
mygenhealth.com
mygenhealth.net
myhealthyresource.com
myhealthyresource.net
myhealthyresources.com
myhealthyresources.net
myhomecare.com
myhr-cvs-login.com
myhr-cvs.com
myhrcvs.com
mylifeguardforhealth.com
myminuteclinc.com
myomniview.com
myworkplaceinfo.com
nassaurxcard.com
nassaurxcard.net
navarro.com
navarroencuesta.com
navarrofacts.com
neighborcare.com
neighborcare.net
neuromedical.com
novologix.com
novologix.net
nuancessalmahayek.com
ocrsho.com
omnicare.com
omnicare.us
omnicareblockchain.com
omnicarecareer.com
omnicarecareerinc.com
omnicarecareers.com
omnicarecareersinc.com
omnicarescg.com
omnicarescg.net
omnicere.com
oncologyassist.com
oncologycarepathways.com
otchs.com
outlierscvs.com
partdcommunity.com
partdinfo.com
partdpeople.com
partdplace.com
pcsaccess.com
pcshs.com
pcsmd.com
pcspharma.com
pcspharmacy.com
pennagt.com
pennlife.com
pennlife.net
pennlifemyd.com
pennlifepresidentsclub.com
pennsylvanialife.com
pharmacistscarerx.com
pharmacistscarerx.net
pharmacistscarerx.us
pharmacyadvantage.com
pharmacyamericas1stchoice.com
pharmacyatcvs.com
pharmacybluecrossmn.com
pharmacyfreedomhealth.com
pharmacyhealthsun.com
pharmacyyouroptimumhealthcare.com
plegcvs.com
preppoint.net
prescribarx.com
prescribarx.net
prescribarx2010.com
prescribarxplans.com
prescriptiondrugcard.com
prescriptionplaninfo.com
pridecvs.com
protecthealthdata.com
racare.com
racare.net
rapidrefills.com
reducedrx.com
rescot.com
revco.com
rsvcare.com
rsvcare.net
rx-r-us.com
rx4mypet.com
rx4mypet.net
rx4mypets.com
rx4mypets.net
rxamerica.us
rxbenefitsalerts.com
rxbenefitsalerts.net
rxclinicalservices.com
rxdamer.com
rxequest.com
rxequest.net
rxformypet.com
rxformypet.net
rxhealthalerts.com
rxhealthalerts.net
rxhealthinfo.com
rxhealthinfo.net
rxhealthnews.com
rxhealthnews.net
rxinsight.com
rxnavigator.com
rxnavigator.net
rxpartners.com
rxpipeline.com
rxpipelineinsider.com
rxplaninfo.com
rxplaninformation.com
rxprintacard.com
rxprintacard.net
rxrequest.com
rxrequest.net
rxsavingplan.com
rxsavingplans.com
rxsavings.com
rxsavingsgold.com
rxsavingsgold.net
rxsavingsplan.com
rxsavingsplan.net
rxsavingsplans.com
rxsavingsplatinum.com
rxsavingsplatinum.net
rxsavingsplus.com
rxsavingsplus.net
rxsavingssilver.com
rxsavingssilver.net
rxuniversalamerican.com
rxuniversalamerican.net
sellyourpharmacy.com
shapeupcvs.com
shopbeauty360.com
silvercsript.com
silverscript.com
silverscript.net
silverscript.us
silverscriptagentportal.com
silverscriptchoice.com
silverscriptinc.com
silverscriptinc.net
silverscriptinsurance.com
silverscriptinsurance.net
silverscriptnow.com
silverscriptonline.com
silverscriptplan.com
silverscriptplan.net
silverscriptplus.com
silverscriptplus.net
silverscriptrx.com
silverscriptrx.net
silverscriptsavings.com
silverscriptwellness.com
silverscriptwellness.net
silversrcipt.com
skineffectsbydrdover.com
skineffectsbydrdover.net
snalfnews.com
snf-online.com
specialtyconditionmanagement.com
specialtyexpedite.net
specialtyingeniorx.com
ssipartd.com
sspdpinfo.com
steamcvs.com
storesownsales.com
supportcvs.com
surveycvs.com
thefailedideasofthepast.com
thepartdpeople.com
thepartdpeople.net
thepartdplace.com
thesoonerthebetter.com
trackmyhealth.com
transplantassist.com
trendsrx.com
trendsrx.net
understand-medicare.com
urgentcarecvs.com
valorcvs.com
vanguardrx.com
vcshealth.com
vcvscaremark.com
vcvshealth.com
vcvspharmacy.com
vickeryandclarke.com
vickeryandclarke.net
vickeryandclarkeapothecary.com
vickeryandclarkeapothecary.net
vickeryandclarkenaturalapothecary.com
vickeryandclarkenaturalapothecary.net
virtualkidneycaresupport.us
vital-reach.com
vvshealth.com
wellpartner.com
wellpartner.net
wellpartnerpharmacy.com
wenourish.com
wenourish.net
wsncvs.com
wwcaremark.com
wwwcareers-cvs.com
wwwcvhealth.com
wwwcvssurvey.com
wwwlongs.com
xcvshealth.com
xvshealth.com
yourcvscaremark.com
yourcvscaremarkonline.com
yourcvscaremarktoday.com
yourhealthconnection.com
yourhealthdelivered.com
yourhealthdelivered.net
yourpetsrx.com

About the Author

Robbie
Robbie Ferguson is an Internet Entrepreneur, Domain Investor, Domain Broker, Blogger and founder of various websites and eCommerce businesses such as ScreenProtectors.co.uk

Leave a Reply

This site uses Akismet to reduce spam. Learn how your comment data is processed.

%d bloggers like this:
Read previous post:
DynaDot domains in auction

It's nearly the end of another week, Thursday is here already and before we know it July shall have disappeared,...

Close